SCOPe 2.07: Domain d4lkjb_: 4lkj B:

Lineage for d4lkjb_ (4lkj B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)

8. Domain d4lkjb_: 4lkj B: [240481]
   Other proteins in same PDB: d4lkja_
   automated match to d1qfub_
   complexed with nag; mutant

Details for d4lkjb_

PDB Entry: 4lkj, 2.8 Å

PDB Description: the structure of hemagglutinin l226q mutant (h3 numbering) from a avian-origin h7n9 influenza virus (a/anhui/1/2013) in complex with avian receptor analog 3'slnln

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4lkjb_:

Sequence; same for both SEQRES and ATOM records:

>d4lkjb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

Timeline for d4lkjb_:

• d4lkjb_ first appeared in SCOPe 2.04
  
• d4lkjb_ appears in SCOPe 2.06
  
• d4lkjb_ appears in the current release, SCOPe 2.08