Lineage for d4lkib_ (4lki B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267482Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)
  8. 2267542Domain d4lkib_: 4lki B: [240480]
    Other proteins in same PDB: d4lkia_
    automated match to d1qfub_
    complexed with nag; mutant

Details for d4lkib_

PDB Entry: 4lki (more details), 2.7 Å

PDB Description: The structure of hemagglutinin L226Q mutant from a avian-origin H7N9 influenza virus (A/Anhui/1/2013)
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4lkib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkib_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

SCOPe Domain Coordinates for d4lkib_:

Click to download the PDB-style file with coordinates for d4lkib_.
(The format of our PDB-style files is described here.)

Timeline for d4lkib_: