Lineage for d4lkgf_ (4lkg F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970048Species Influenza A virus [TaxId:11320] [255822] (17 PDB entries)
  8. 1970110Domain d4lkgf_: 4lkg F: [240479]
    Other proteins in same PDB: d4lkga_, d4lkgc_, d4lkge_
    automated match to d2viub_
    complexed with nag

Details for d4lkgf_

PDB Entry: 4lkg (more details), 2.99 Å

PDB Description: the structure of hemagglutinin from a avian-origin h7n9 influenza virus (a/shanghai/1/2013) in complex with avian receptor analog 3'slnln
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4lkgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkgf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

SCOPe Domain Coordinates for d4lkgf_:

Click to download the PDB-style file with coordinates for d4lkgf_.
(The format of our PDB-style files is described here.)

Timeline for d4lkgf_: