Lineage for d4lkgd_ (4lkg D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709788Species Influenza A virus [TaxId:11320] [255822] (11 PDB entries)
  8. 1709804Domain d4lkgd_: 4lkg D: [240478]
    Other proteins in same PDB: d4lkga_, d4lkgc_, d4lkge_
    automated match to d2viub_
    complexed with nag

Details for d4lkgd_

PDB Entry: 4lkg (more details), 2.99 Å

PDB Description: The structure of hemagglutinin from a avian-origin H7N9 influenza virus (A/Shanghai/1/2013) in complex with avian receptor analog 3'SLNLN
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4lkgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkgd_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

SCOPe Domain Coordinates for d4lkgd_:

Click to download the PDB-style file with coordinates for d4lkgd_.
(The format of our PDB-style files is described here.)

Timeline for d4lkgd_: