SCOPe 2.04: Domain d4lkgb_: 4lkg B:

Lineage for d4lkgb_ (4lkg B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (27 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255822] (11 PDB entries)

8. Domain d4lkgb_: 4lkg B: [240477]
   Other proteins in same PDB: d4lkga_, d4lkgc_, d4lkge_
   automated match to d2viub_
   complexed with nag

Details for d4lkgb_

PDB Entry: 4lkg, 2.99 Å

PDB Description: the structure of hemagglutinin from a avian-origin h7n9 influenza virus (a/shanghai/1/2013) in complex with avian receptor analog 3'slnln

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4lkgb_:

Sequence; same for both SEQRES and ATOM records:

>d4lkgb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

Timeline for d4lkgb_:

• d4lkgb_ is new in SCOPe 2.04-stable
  
• d4lkgb_ appears in SCOPe 2.05
  
• d4lkgb_ appears in the current release, SCOPe 2.08