![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (29 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries) |
![]() | Domain d4lkgb_: 4lkg B: [240477] Other proteins in same PDB: d4lkga_, d4lkgc_, d4lkge_ automated match to d2viub_ complexed with nag |
PDB Entry: 4lkg (more details), 2.99 Å
SCOPe Domain Sequences for d4lkgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkgb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
Timeline for d4lkgb_: