| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
| Protein automated matches [226860] (37 species) not a true protein |
| Species Pseudoalteromonas haloplanktis [TaxId:228] [237182] (3 PDB entries) |
| Domain d4l2cd2: 4l2c D:83-192 [240470] Other proteins in same PDB: d4l2ca1, d4l2cb1, d4l2cc1, d4l2cd1 automated match to d4l2ca2 complexed with fe, tre; mutant |
PDB Entry: 4l2c (more details), 1.66 Å
SCOPe Domain Sequences for d4l2cd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2cd2 d.44.1.0 (D:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa
Timeline for d4l2cd2: