Lineage for d4l2cd2 (4l2c D:83-192)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553376Species Pseudoalteromonas haloplanktis [TaxId:228] [237182] (3 PDB entries)
  8. 2553380Domain d4l2cd2: 4l2c D:83-192 [240470]
    Other proteins in same PDB: d4l2ca1, d4l2cb1, d4l2cc1, d4l2cd1
    automated match to d4l2ca2
    complexed with fe, tre; mutant

Details for d4l2cd2

PDB Entry: 4l2c (more details), 1.66 Å

PDB Description: x-ray structure of the c57r mutant of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form i)
PDB Compounds: (D:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2cd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2cd2 d.44.1.0 (D:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa

SCOPe Domain Coordinates for d4l2cd2:

Click to download the PDB-style file with coordinates for d4l2cd2.
(The format of our PDB-style files is described here.)

Timeline for d4l2cd2: