Lineage for d1lte__ (1lte -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Lectin [49904] (15 species) 
Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (7 PDB entries) 
Domain d1lte__: 1lte - [24047]
Details for d1lte__
PDB Entry: 1lte (more details), 2 Å
PDB Description: structure of a legume lectin with an ordered n-linked carbohydrate in complex with lactose
SCOP Domain Sequences for d1lte__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lte__ b.29.1.1 (-) Lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnqskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
SCOP Domain Coordinates for d1lte__:
Click to download the PDB-style file with coordinates for d1lte__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lte__:
- d1lte__ appears in SCOP 1.57
- d1lte__ appears in the current release, SCOPe 2.08, called d1ltea_
View in 3D