SCOPe 2.06: Domain d4l2cc1: 4l2c C:1-82

Lineage for d4l2cc1 (4l2c C:1-82)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (32 species)
   not a true protein

7. Species Pseudoalteromonas haloplanktis [TaxId:228] [237179] (3 PDB entries)

8. Domain d4l2cc1: 4l2c C:1-82 [240467]
   Other proteins in same PDB: d4l2ca2, d4l2cb2, d4l2cc2, d4l2cd2
   automated match to d4l2ca1
   complexed with fe, tre; mutant

Details for d4l2cc1

PDB Entry: 4l2c, 1.66 Å

PDB Description: x-ray structure of the c57r mutant of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form i)

PDB Compounds: (C:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2cc1:

Sequence; same for both SEQRES and ATOM records:

>d4l2cc1 a.2.11.0 (C:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd
ggvfnnaaqiwnhtfywnslsp

Timeline for d4l2cc1:

• d4l2cc1 first appeared in SCOPe 2.04
  
• d4l2cc1 appears in SCOPe 2.05
  
• d4l2cc1 appears in SCOPe 2.07
  
• d4l2cc1 appears in the current release, SCOPe 2.08