Lineage for d4l2cc1 (4l2c C:1-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690534Species Pseudoalteromonas haloplanktis [TaxId:228] [237179] (3 PDB entries)
  8. 2690537Domain d4l2cc1: 4l2c C:1-82 [240467]
    Other proteins in same PDB: d4l2ca2, d4l2cb2, d4l2cc2, d4l2cd2
    automated match to d4l2ca1
    complexed with fe; mutant

Details for d4l2cc1

PDB Entry: 4l2c (more details), 1.66 Å

PDB Description: x-ray structure of the c57r mutant of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form i)
PDB Compounds: (C:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2cc1 a.2.11.0 (C:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd
ggvfnnaaqiwnhtfywnslsp

SCOPe Domain Coordinates for d4l2cc1:

Click to download the PDB-style file with coordinates for d4l2cc1.
(The format of our PDB-style files is described here.)

Timeline for d4l2cc1: