![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Pseudoalteromonas haloplanktis [TaxId:228] [237179] (3 PDB entries) |
![]() | Domain d4l2cc1: 4l2c C:1-82 [240467] Other proteins in same PDB: d4l2ca2, d4l2cb2, d4l2cc2, d4l2cd2 automated match to d4l2ca1 complexed with fe; mutant |
PDB Entry: 4l2c (more details), 1.66 Å
SCOPe Domain Sequences for d4l2cc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2cc1 a.2.11.0 (C:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]} afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd ggvfnnaaqiwnhtfywnslsp
Timeline for d4l2cc1: