Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Pseudoalteromonas haloplanktis [TaxId:228] [237182] (3 PDB entries) |
Domain d4l2bb2: 4l2b B:83-192 [240466] Other proteins in same PDB: d4l2ba1, d4l2bb1 automated match to d4l2ba2 complexed with fe; mutant |
PDB Entry: 4l2b (more details), 1.97 Å
SCOPe Domain Sequences for d4l2bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2bb2 d.44.1.0 (B:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]} ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa
Timeline for d4l2bb2: