SCOPe 2.04: Domain d4l04d_: 4l04 D:

Lineage for d4l04d_ (4l04 D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189131] (9 PDB entries)

8. Domain d4l04d_: 4l04 D: [240462]
   automated match to d4l04b_
   complexed with akg, ca, nap; mutant

Details for d4l04d_

PDB Entry: 4l04, 2.87 Å

PDB Description: crystal structure analysis of human idh1 mutants in complex with nadp+ and ca2+/alpha-ketoglutarate

PDB Compounds: (D:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d4l04d_:

Sequence; same for both SEQRES and ATOM records:

>d4l04d_ c.77.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspnntirnilggtvfreaiickniprlvs
gwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

Timeline for d4l04d_:

• d4l04d_ is new in SCOPe 2.04-stable
  
• d4l04d_ appears in SCOPe 2.05
  
• d4l04d_ appears in the current release, SCOPe 2.08