Class b: All beta proteins [48724] (149 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) |
Family b.29.1.1: Legume lectins [49900] (4 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries) |
Domain d1ax2__: 1ax2 - [24045] complexed with ca, fuc, gal, man, mn, nag, xys |
PDB Entry: 1ax2 (more details), 1.95 Å
SCOP Domain Sequences for d1ax2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ax2__ b.29.1.1 (-) Legume lectin {Coral tree (Erythrina corallodendron)} vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
Timeline for d1ax2__: