Lineage for d1ax2__ (1ax2 -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 555834Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 555962Protein Legume lectin [49904] (23 species)
  7. 556006Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
  8. 556011Domain d1ax2__: 1ax2 - [24045]
    complexed with ca, fuc, gal, man, mn, nag, xys

Details for d1ax2__

PDB Entry: 1ax2 (more details), 1.95 Å

PDB Description: erythrina corallodendron lectin in complex with n-acetyllactosamine

SCOP Domain Sequences for d1ax2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ax2__ b.29.1.1 (-) Legume lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOP Domain Coordinates for d1ax2__:

Click to download the PDB-style file with coordinates for d1ax2__.
(The format of our PDB-style files is described here.)

Timeline for d1ax2__: