Lineage for d1ax2__ (1ax2 -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Legume lectin [49904] (20 species) 
Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (7 PDB entries) 
Domain d1ax2__: 1ax2 - [24045]
Details for d1ax2__
PDB Entry: 1ax2 (more details), 1.95 Å
PDB Description: erythrina corallodendron lectin in complex with n-acetyllactosamine
SCOP Domain Sequences for d1ax2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ax2__ b.29.1.1 (-) Legume lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
SCOP Domain Coordinates for d1ax2__:
Click to download the PDB-style file with coordinates for d1ax2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ax2__:
- d1ax2__ first appeared (with stable ids) in SCOP 1.55
- d1ax2__ appears in SCOP 1.59
- d1ax2__ appears in SCOP 1.63
- d1ax2__ appears in the current release, SCOPe 2.08, called d1ax2a_
View in 3D