Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein automated matches [232361] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232384] (3 PDB entries) |
Domain d4krma1: 4krm A:307-480 [240444] Other proteins in same PDB: d4krma2, d4krmb_, d4krmc2, d4krmd_, d4krme2, d4krmf_, d4krmh_, d4krmi2, d4krmj_, d4krmk2, d4krml_ automated match to d4krla1 complexed with nag |
PDB Entry: 4krm (more details), 2.65 Å
SCOPe Domain Sequences for d4krma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4krma1 c.10.2.5 (A:307-480) automated matches {Human (Homo sapiens) [TaxId: 9606]} leekkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpq eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslgl rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
Timeline for d4krma1: