Lineage for d1ax1__ (1ax1 -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371285Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (7 PDB entries)
  8. 371287Domain d1ax1__: 1ax1 - [24044]
    complexed with ca, fuc, gal, glc, man, mn, nag, xys

Details for d1ax1__

PDB Entry: 1ax1 (more details), 1.95 Å

PDB Description: erythrina corallodendron lectin in complex with lactose

SCOP Domain Sequences for d1ax1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ax1__ b.29.1.1 (-) Legume lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOP Domain Coordinates for d1ax1__:

Click to download the PDB-style file with coordinates for d1ax1__.
(The format of our PDB-style files is described here.)

Timeline for d1ax1__: