SCOPe 2.08: Domain d1ax1a_: 1ax1 A:

Lineage for d1ax1a_ (1ax1 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
   Uniprot P16404

8. Domain d1ax1a_: 1ax1 A: [24044]
   complexed with ca, mn

Details for d1ax1a_

PDB Entry: 1ax1, 1.95 Å

PDB Description: erythrina corallodendron lectin in complex with lactose

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1ax1a_:

Sequence; same for both SEQRES and ATOM records:

>d1ax1a_ b.29.1.1 (A:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

Timeline for d1ax1a_:

• d1ax1a_ first appeared (with stable ids) in SCOP 1.55, called d1ax1__
  
• d1ax1a_ appears in SCOPe 2.07