Lineage for d4kpqd_ (4kpq D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645575Domain d4kpqd_: 4kpq D: [240438]
    Other proteins in same PDB: d4kpqa1, d4kpqa2, d4kpqc1, d4kpqc2, d4kpqe1, d4kpqe2
    automated match to d1rd8b_
    complexed with nag

Details for d4kpqd_

PDB Entry: 4kpq (more details), 2.5 Å

PDB Description: structure and receptor binding specificity of the hemagglutinin h13 from avian influenza a virus h13n6
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4kpqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpqd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwpglingwygfqhqneqgtgiaadkestqkaidqittkinniidkmng
nydsirgefnqvekrinmladriddavtdiwsynakllvllendktldmhdanvknlheq
vrrelkdnaidegngcfellhkcndscmetirngtydhteyaees

SCOPe Domain Coordinates for d4kpqd_:

Click to download the PDB-style file with coordinates for d4kpqd_.
(The format of our PDB-style files is described here.)

Timeline for d4kpqd_: