SCOPe 2.04: Domain d4kolb_: 4kol B:

Lineage for d4kolb_ (4kol B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (7 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)

8. Domain d4kolb_: 4kol B: [240434]
   Other proteins in same PDB: d4kola_
   automated match to d1qfub_
   complexed with nag

Details for d4kolb_

PDB Entry: 4kol, 2.8 Å

PDB Description: the structure of hemagglutinin from avian-origin h7n9 influenza virus

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4kolb_:

Sequence; same for both SEQRES and ATOM records:

>d4kolb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
agfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfeli
dnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkrql
renaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

Timeline for d4kolb_:

• d4kolb_ is new in SCOPe 2.04-stable
  
• d4kolb_ appears in SCOPe 2.05
  
• d4kolb_ appears in the current release, SCOPe 2.08