![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries) |
![]() | Domain d4kntb2: 4knt B:154-309 [240433] automated match to d4kntc2 complexed with cu, gol |
PDB Entry: 4knt (more details), 1.9 Å
SCOPe Domain Sequences for d4kntb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kntb2 b.6.1.0 (B:154-309) automated matches {Nitrosomonas europaea [TaxId: 228410]} dreyvliqaehyenpddktammqnkwsnvvfnggvfkydpvhdseatswlqakpgervri yfvnagpnelsslhpiagiwdrvypsgnpknvqyalqsyligagdaatldlispvegana ivdhsmrhahsgaiavimftndadpeagrgenilir
Timeline for d4kntb2:
![]() Domains from other chains: (mouse over for more information) d4knta1, d4knta2, d4kntc1, d4kntc2 |