| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries) |
| Domain d4knta1: 4knt A:25-153 [240430] automated match to d4kntc1 complexed with cu, gol |
PDB Entry: 4knt (more details), 1.9 Å
SCOPe Domain Sequences for d4knta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4knta1 b.6.1.0 (A:25-153) automated matches {Nitrosomonas europaea [TaxId: 228410]}
ktvqvtlhavetdvaydnkgstyrawtfdgkvpgpvvrvtegdtveftlindknsknshs
mdfhaarldvvedfesikpgetkkytftadnpgvffyhcgsdpmiqhiargmygviivdp
kdanalpka
Timeline for d4knta1:
View in 3DDomains from other chains: (mouse over for more information) d4kntb1, d4kntb2, d4kntc1, d4kntc2 |