SCOP 1.67: Domain d1axy__: 1axy -

Lineage for d1axy__ (1axy -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (7 PDB entries)

8. Domain d1axy__: 1axy - [24043]
   complexed with ca, fuc, man, mn, nag, xys

Details for d1axy__

PDB Entry: 1axy, 1.95 Å

PDB Description: erythrina corallodendron lectin

SCOP Domain Sequences for d1axy__:

Sequence; same for both SEQRES and ATOM records:

>d1axy__ b.29.1.1 (-) Legume lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

Timeline for d1axy__:

• d1axy__ first appeared (with stable ids) in SCOP 1.55
  
• d1axy__ appears in SCOP 1.65
  
• d1axy__ appears in SCOP 1.69
  
• d1axy__ appears in the current release, SCOPe 2.08, called d1axya_