Lineage for d1axy__ (1axy -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294478Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 294600Protein Legume lectin [49904] (22 species)
  7. 294622Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (7 PDB entries)
  8. 294625Domain d1axy__: 1axy - [24043]
    complexed with ca, fuc, man, mn, nag, xys

Details for d1axy__

PDB Entry: 1axy (more details), 1.95 Å

PDB Description: erythrina corallodendron lectin

SCOP Domain Sequences for d1axy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axy__ b.29.1.1 (-) Legume lectin {Coral tree (Erythrina corallodendron)}
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOP Domain Coordinates for d1axy__:

Click to download the PDB-style file with coordinates for d1axy__.
(The format of our PDB-style files is described here.)

Timeline for d1axy__: