![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries) Uniprot P16404 |
![]() | Domain d1axya_: 1axy A: [24043] complexed with ca, mn |
PDB Entry: 1axy (more details), 1.95 Å
SCOPe Domain Sequences for d1axya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axya_ b.29.1.1 (A:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]} vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
Timeline for d1axya_: