| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries) |
| Domain d4knse1: 4kns E:25-153 [240428] automated match to d4kntc1 complexed with cl, cu, gol |
PDB Entry: 4kns (more details), 2.2 Å
SCOPe Domain Sequences for d4knse1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4knse1 b.6.1.0 (E:25-153) automated matches {Nitrosomonas europaea [TaxId: 228410]}
ktvqvtlhavetdvaydnkgstyrawtfdgkvpgpvvrvtegdtveftlindknsknshs
mdfhaarldvvedfesikpgetkkytftadnpgvffyhcgsdpmiqhiargmygviivdp
kdanalpka
Timeline for d4knse1: