Lineage for d4kn8a_ (4kn8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920486Species Geobacillus stearothermophilus [TaxId:1422] [229821] (4 PDB entries)
  8. 2920487Domain d4kn8a_: 4kn8 A: [240425]
    automated match to d4kn8b_

Details for d4kn8a_

PDB Entry: 4kn8 (more details), 1.5 Å

PDB Description: Crystal structure of Bs-TpNPPase
PDB Compounds: (A:) Thermostable NPPase

SCOPe Domain Sequences for d4kn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kn8a_ c.108.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl
dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl
drevtyeklavaclavrngaklistngdlalptergfmpgngaftalishstqvkatfvg
kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq
qptysmkslddwkfl

SCOPe Domain Coordinates for d4kn8a_:

Click to download the PDB-style file with coordinates for d4kn8a_.
(The format of our PDB-style files is described here.)

Timeline for d4kn8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4kn8b_