Lineage for d4kg3b_ (4kg3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971796Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [235108] (4 PDB entries)
  8. 2971798Domain d4kg3b_: 4kg3 B: [240422]
    automated match to d4kg3c_
    protein/RNA complex; complexed with mg; mutant

Details for d4kg3b_

PDB Entry: 4kg3 (more details), 1.7 Å

PDB Description: Crystal structure of Saccharomyces cerevisiae Dcp2 Nudix domain in complex with Mg (E153Q mutation)
PDB Compounds: (B:) mRNA-decapping enzyme subunit 2

SCOPe Domain Sequences for d4kg3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kg3b_ d.113.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ksipvrgaaifnenlskillvqgtesdswsfprgkiskdendidccirevkeqigfdltd
yiddnqfierniqgknykiflisgvsevfnfkpqvrneidkiewfdfkkisktmyksnik
yylinsmmrplsmwlrhqrqikned

SCOPe Domain Coordinates for d4kg3b_:

Click to download the PDB-style file with coordinates for d4kg3b_.
(The format of our PDB-style files is described here.)

Timeline for d4kg3b_: