| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
| Protein automated matches [191036] (17 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [235108] (4 PDB entries) |
| Domain d4kg3b_: 4kg3 B: [240422] automated match to d4kg3c_ protein/RNA complex; complexed with mg; mutant |
PDB Entry: 4kg3 (more details), 1.7 Å
SCOPe Domain Sequences for d4kg3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kg3b_ d.113.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ksipvrgaaifnenlskillvqgtesdswsfprgkiskdendidccirevkeqigfdltd
yiddnqfierniqgknykiflisgvsevfnfkpqvrneidkiewfdfkkisktmyksnik
yylinsmmrplsmwlrhqrqikned
Timeline for d4kg3b_: