SCOPe 2.04: Domain d4kdqb_: 4kdq B:

Lineage for d4kdqb_ (4kdq B:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (7 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)

8. Domain d4kdqb_: 4kdq B: [240417]
   Other proteins in same PDB: d4kdqa_, d4kdqc_, d4kdqe_
   automated match to d1qfub_
   complexed with nag

Details for d4kdqb_

PDB Entry: 4kdq, 2.6 Å

PDB Description: crystal structure of the hemagglutinin of a/xinjiang/1/2006 virus

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4kdqb_:

Sequence; same for both SEQRES and ATOM records:

>d4kdqb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyse

Timeline for d4kdqb_:

• d4kdqb_ is new in SCOPe 2.04-stable
  
• d4kdqb_ appears in SCOPe 2.05
  
• d4kdqb_ appears in the current release, SCOPe 2.08