Lineage for d4kdob_ (4kdo B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267158Domain d4kdob_: 4kdo B: [240413]
    Other proteins in same PDB: d4kdoa1, d4kdoa2, d4kdoc1, d4kdoc2, d4kdoe1, d4kdoe2
    automated match to d1rd8b_
    complexed with nag, sia

Details for d4kdob_

PDB Entry: 4kdo (more details), 2.4 Å

PDB Description: Crystal structure of the hemagglutinin of ferret-transmissible H5N1 virus in complex with human receptor analog LSTc
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4kdob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdob_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeisg

SCOPe Domain Coordinates for d4kdob_:

Click to download the PDB-style file with coordinates for d4kdob_.
(The format of our PDB-style files is described here.)

Timeline for d4kdob_: