Lineage for d1gsl__ (1gsl -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371490Species West-central african legume (Griffonia simplicifolia) [TaxId:3850] [49907] (3 PDB entries)
  8. 371492Domain d1gsl__: 1gsl - [24041]
    complexed with ca, fuc, gal, mag, man, mn, nag

Details for d1gsl__

PDB Entry: 1gsl (more details), 2 Å

PDB Description: lectin (fourth isolated from (griffonia simplicifolia)) complex with y human blood group determinant

SCOP Domain Sequences for d1gsl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsl__ b.29.1.1 (-) Legume lectin {West-central african legume (Griffonia simplicifolia)}
entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
tnk

SCOP Domain Coordinates for d1gsl__:

Click to download the PDB-style file with coordinates for d1gsl__.
(The format of our PDB-style files is described here.)

Timeline for d1gsl__: