Lineage for d4kdmf_ (4kdm F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041136Domain d4kdmf_: 4kdm F: [240409]
    Other proteins in same PDB: d4kdma1, d4kdma2, d4kdmc1, d4kdmc2, d4kdme1, d4kdme2
    automated match to d1rd8b_
    complexed with nag

Details for d4kdmf_

PDB Entry: 4kdm (more details), 2.5 Å

PDB Description: crystal structure of the hemagglutinin of ferret-transmissible h5n1 virus
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4kdmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdmf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeisg

SCOPe Domain Coordinates for d4kdmf_:

Click to download the PDB-style file with coordinates for d4kdmf_.
(The format of our PDB-style files is described here.)

Timeline for d4kdmf_: