| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Bacteroides vulgatus [TaxId:435590] [194549] (5 PDB entries) |
| Domain d4ka0d_: 4ka0 D: [240403] automated match to d4ka0a_ complexed with cl |
PDB Entry: 4ka0 (more details), 2.1 Å
SCOPe Domain Sequences for d4ka0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ka0d_ c.47.1.0 (D:) automated matches {Bacteroides vulgatus [TaxId: 435590]}
askllpgqpaidfemldvegnvkhladfkgkviyidlwatwcgpciqespafealgkkyv
gkdivflpvstdtttkpwlryldghkkeltqyhsndvalkeswaimyiprfilidkdfni
vnayaprpsseeigtlidsvl
Timeline for d4ka0d_: