Lineage for d4ka0d_ (4ka0 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879127Species Bacteroides vulgatus [TaxId:435590] [194549] (5 PDB entries)
  8. 2879132Domain d4ka0d_: 4ka0 D: [240403]
    automated match to d4ka0a_
    complexed with cl

Details for d4ka0d_

PDB Entry: 4ka0 (more details), 2.1 Å

PDB Description: Crystal structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus (target NYSGRC-011676), space group P21221
PDB Compounds: (D:) Putative thiol-disulfide oxidoreductase

SCOPe Domain Sequences for d4ka0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ka0d_ c.47.1.0 (D:) automated matches {Bacteroides vulgatus [TaxId: 435590]}
askllpgqpaidfemldvegnvkhladfkgkviyidlwatwcgpciqespafealgkkyv
gkdivflpvstdtttkpwlryldghkkeltqyhsndvalkeswaimyiprfilidkdfni
vnayaprpsseeigtlidsvl

SCOPe Domain Coordinates for d4ka0d_:

Click to download the PDB-style file with coordinates for d4ka0d_.
(The format of our PDB-style files is described here.)

Timeline for d4ka0d_: