Lineage for d1leca_ (1lec A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663622Species West-central african legume (Griffonia simplicifolia) [TaxId:3850] [49907] (3 PDB entries)
  8. 663625Domain d1leca_: 1lec A: [24040]
    complexed with ca, fuc, mn, nag, so4

Details for d1leca_

PDB Entry: 1lec (more details), 2 Å

PDB Description: structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution
PDB Compounds: (A:) west-central african legume lectin IV

SCOP Domain Sequences for d1leca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leca_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]}
entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
tnk

SCOP Domain Coordinates for d1leca_:

Click to download the PDB-style file with coordinates for d1leca_.
(The format of our PDB-style files is described here.)

Timeline for d1leca_: