SCOP 1.73: Domain d1leda_: 1led A:

Lineage for d1leda_ (1led A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species West-central african legume (Griffonia simplicifolia) [TaxId:3850] [49907] (3 PDB entries)

8. Domain d1leda_: 1led A: [24039]
   complexed with ca, fuc, gal, mn, nag, so4

Details for d1leda_

PDB Entry: 1led, 2 Å

PDB Description: structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution

PDB Compounds: (A:) west-central african legume lectin IV

SCOP Domain Sequences for d1leda_:

Sequence; same for both SEQRES and ATOM records:

>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]}
entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
tnk

Timeline for d1leda_:

• d1leda_ first appeared (with stable ids) in SCOP 1.55, called d1led__
  
• d1leda_ was called d1led__ in SCOP 1.71
  
• d1leda_ appears in SCOP 1.75
  
• d1leda_ appears in the current release, SCOPe 2.08