SCOP 1.71: Domain d1led__: 1led -

Lineage for d1led__ (1led -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species West-central african legume (Griffonia simplicifolia) [TaxId:3850] [49907] (3 PDB entries)

8. Domain d1led__: 1led - [24039]
   complexed with ca, fuc, gal, mn, nag, so4

Details for d1led__

PDB Entry: 1led, 2 Å

PDB Description: structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution

SCOP Domain Sequences for d1led__:

Sequence; same for both SEQRES and ATOM records:

>d1led__ b.29.1.1 (-) Legume lectin {West-central african legume (Griffonia simplicifolia)}
entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
tnk

Timeline for d1led__:

• d1led__ first appeared (with stable ids) in SCOP 1.55
  
• d1led__ appears in SCOP 1.69
  
• d1led__ is called d1leda_ in SCOP 1.73
  
• d1led__ appears in the current release, SCOPe 2.08, called d1leda_