Lineage for d1led__ (1led -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 459807Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 459934Protein Legume lectin [49904] (23 species)
  7. 460189Species West-central african legume (Griffonia simplicifolia) [TaxId:3850] [49907] (3 PDB entries)
  8. 460190Domain d1led__: 1led - [24039]

Details for d1led__

PDB Entry: 1led (more details), 2 Å

PDB Description: structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution

SCOP Domain Sequences for d1led__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1led__ b.29.1.1 (-) Legume lectin {West-central african legume (Griffonia simplicifolia)}
entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
tnk

SCOP Domain Coordinates for d1led__:

Click to download the PDB-style file with coordinates for d1led__.
(The format of our PDB-style files is described here.)

Timeline for d1led__: