![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
![]() | Domain d4k64h_: 4k64 H: [240386] Other proteins in same PDB: d4k64a1, d4k64a2, d4k64c1, d4k64c2, d4k64e1, d4k64e2, d4k64g1, d4k64g2 automated match to d2ypgb_ complexed with nag |
PDB Entry: 4k64 (more details), 2.6 Å
SCOPe Domain Sequences for d4k64h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k64h_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse
Timeline for d4k64h_: