Lineage for d4k62h_ (4k62 H:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709495Domain d4k62h_: 4k62 H: [240382]
    Other proteins in same PDB: d4k62a_, d4k62c_, d4k62e_, d4k62g_
    automated match to d2ypgb_
    complexed with nag

Details for d4k62h_

PDB Entry: 4k62 (more details), 2.5 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus a/indonesia/5/2005
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d4k62h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k62h_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse

SCOPe Domain Coordinates for d4k62h_:

Click to download the PDB-style file with coordinates for d4k62h_.
(The format of our PDB-style files is described here.)

Timeline for d4k62h_: