Lineage for d1lem.1 (1lem A:,B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371277Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 371284Domain d1lem.1: 1lem A:,B: [24038]
    complexed with ca, glc, mn

Details for d1lem.1

PDB Entry: 1lem (more details), 3 Å

PDB Description: the monosaccharide binding site of lentil lectin: an x-ray and molecular modelling study

SCOP Domain Sequences for d1lem.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lem.1 b.29.1.1 (A:,B:) Legume lectin {Common lentil (Lens culinaris)}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg

SCOP Domain Coordinates for d1lem.1:

Click to download the PDB-style file with coordinates for d1lem.1.
(The format of our PDB-style files is described here.)

Timeline for d1lem.1: