Lineage for d1lem.1 (1lem A:,B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Lectin [49904] (15 species) 
Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries) 
Domain d1lem.1: 1lem A:,B: [24038]
Details for d1lem.1
PDB Entry: 1lem (more details), 3 Å
PDB Description: the monosaccharide binding site of lentil lectin: an x-ray and molecular modelling study
SCOP Domain Sequences for d1lem.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1lem.1 b.29.1.1 (A:,B:) Lectin {Common lentil (Lens culinaris)}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg
SCOP Domain Coordinates for d1lem.1:
Click to download the PDB-style file with coordinates for d1lem.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lem.1:
- d1lem.1 appears in SCOP 1.57
- d1lem.1 appears in the current release, SCOPe 2.08
View in 3D