SCOPe 2.08: Domain d1lem.1: 1lem A:,B:

Lineage for d1lem.1 (1lem A:,B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
   two-chain protein resulted from a single-chain precursor

8. Domain d1lem.1: 1lem A:,B: [24038]
   complexed with ca, glc, mn

Details for d1lem.1

PDB Entry: 1lem, 3 Å

PDB Description: the monosaccharide binding site of lentil lectin: an x-ray and molecular modelling study

PDB Compounds: (A:) lectin, (B:) lectin

SCOPe Domain Sequences for d1lem.1:

Sequence; same for both SEQRES and ATOM records:

>g1lem.1 b.29.1.1 (A:,B:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg

Timeline for d1lem.1:

• d1lem.1 first appeared (with stable ids) in SCOP 1.55
  
• d1lem.1 appears in SCOPe 2.07