Lineage for d4k62b_ (4k62 B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267035Domain d4k62b_: 4k62 B: [240379]
    Other proteins in same PDB: d4k62a1, d4k62a2, d4k62c1, d4k62c2, d4k62e1, d4k62e2, d4k62g1, d4k62g2
    automated match to d2ypgb_
    complexed with nag

Details for d4k62b_

PDB Entry: 4k62 (more details), 2.5 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus a/indonesia/5/2005
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4k62b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k62b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse

SCOPe Domain Coordinates for d4k62b_:

Click to download the PDB-style file with coordinates for d4k62b_.
(The format of our PDB-style files is described here.)

Timeline for d4k62b_: