Lineage for d4k3xf1 (4k3x F:6-174)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267482Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)
  8. 2267485Domain d4k3xf1: 4k3x F:6-174 [240378]
    Other proteins in same PDB: d4k3xa_, d4k3xb2, d4k3xc_, d4k3xd2, d4k3xe_, d4k3xf2
    automated match to d4n5zb_
    complexed with nag, p4g

Details for d4k3xf1

PDB Entry: 4k3x (more details), 2.15 Å

PDB Description: Crystal structure of a subtype H18 hemagglutinin homologue from A/flat-faced bat/Peru/033/2010 (H18N11)
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d4k3xf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3xf1 h.3.1.1 (F:6-174) automated matches {Influenza A virus [TaxId: 11320]}
iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkid

SCOPe Domain Coordinates for d4k3xf1:

Click to download the PDB-style file with coordinates for d4k3xf1.
(The format of our PDB-style files is described here.)

Timeline for d4k3xf1: