Lineage for d4k3xb1 (4k3x B:6-174)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646215Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)
  8. 2646225Domain d4k3xb1: 4k3x B:6-174 [240376]
    Other proteins in same PDB: d4k3xa_, d4k3xb2, d4k3xc_, d4k3xd2, d4k3xe_, d4k3xf2
    automated match to d4n5zb_
    complexed with nag, p4g

Details for d4k3xb1

PDB Entry: 4k3x (more details), 2.15 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4k3xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3xb1 h.3.1.1 (B:6-174) automated matches {Influenza A virus, different strains [TaxId: 11320]}
iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkid

SCOPe Domain Coordinates for d4k3xb1:

Click to download the PDB-style file with coordinates for d4k3xb1.
(The format of our PDB-style files is described here.)

Timeline for d4k3xb1: