Lineage for d4k3xb_ (4k3x B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970048Species Influenza A virus [TaxId:11320] [255822] (17 PDB entries)
  8. 1970049Domain d4k3xb_: 4k3x B: [240376]
    Other proteins in same PDB: d4k3xa_, d4k3xc_, d4k3xe_
    automated match to d4n5zb_
    complexed with nag, p4g

Details for d4k3xb_

PDB Entry: 4k3x (more details), 2.15 Å

PDB Description: Crystal structure of a subtype H18 hemagglutinin homologue from A/flat-faced bat/Peru/033/2010 (H18N11)
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4k3xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3xb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkids

SCOPe Domain Coordinates for d4k3xb_:

Click to download the PDB-style file with coordinates for d4k3xb_.
(The format of our PDB-style files is described here.)

Timeline for d4k3xb_: