Lineage for d4k3vb_ (4k3v B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143658Species Staphylococcus aureus [TaxId:869816] [235084] (1 PDB entry)
  8. 2143660Domain d4k3vb_: 4k3v B: [240373]
    automated match to d4k3va_
    complexed with mn

Details for d4k3vb_

PDB Entry: 4k3v (more details), 2.2 Å

PDB Description: Structure of Staphylococcus aureus MntC
PDB Compounds: (B:) ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d4k3vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3vb_ c.92.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 869816]}
gklkvvttnsilydmaknvggdnvdihsivpvgqdpheyevkpkdikkltdadvilyngl
nletgngwfekaleqagkslkdkkviavskdvkpiylngeegnkdkqdphawlsldngik
yvktiqqtfidndkkhkadyekqgnkyiaqleklnndskdkfndipkeqramitsegafk
yfskqygitpgyiweintekqgtpeqmrqaiefvkkhklkhllvetsvdkkameslseet
kkdifgevytdsigkegtkgdsyykmmksnietvhgsm

SCOPe Domain Coordinates for d4k3vb_:

Click to download the PDB-style file with coordinates for d4k3vb_.
(The format of our PDB-style files is described here.)

Timeline for d4k3vb_: