Lineage for d4k1zb_ (4k1z B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388561Protein automated matches [190035] (28 species)
    not a true protein
  7. 2388614Species Canavalia boliviana [TaxId:232300] [238384] (3 PDB entries)
  8. 2388617Domain d4k1zb_: 4k1z B: [240372]
    automated match to d4k1za_
    complexed with ca, cd, cl, mn

Details for d4k1zb_

PDB Entry: 4k1z (more details), 2.3 Å

PDB Description: crystal structure of canavalia boliviana lectin in complex with man1- 4man-ome
PDB Compounds: (B:) Canavalia boliviana lectin

SCOPe Domain Sequences for d4k1zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1zb_ b.29.1.1 (B:) automated matches {Canavalia boliviana [TaxId: 232300]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgrdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4k1zb_:

Click to download the PDB-style file with coordinates for d4k1zb_.
(The format of our PDB-style files is described here.)

Timeline for d4k1zb_: