SCOPe 2.06: Domain d4k1fd_: 4k1f D:

Lineage for d4k1fd_ (4k1f D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [226407] (3 PDB entries)

8. Domain d4k1fd_: 4k1f D: [240370]
   automated match to d4k1fa_
   complexed with cl, pe8, peg, pge

Details for d4k1fd_

PDB Entry: 4k1f, 2.34 Å

PDB Description: crystal structure of reduced tryparedoxin peroxidase from leishmania major at 2.34 a resolution

PDB Compounds: (D:) tryparedoxin peroxidase

SCOPe Domain Sequences for d4k1fd_:

Sequence; same for both SEQRES and ATOM records:

>d4k1fd_ c.47.1.10 (D:) automated matches {Leishmania major [TaxId: 5664]}
cgnakinspapsfeevalmpngsfkkislssykgkwvvlffypldftfvcpteviafsds
vsrfnelncevlacsidseyahlqwtlqdrkkgglgtmaipiladktkniarsygvlees
qgvayrglfiidphgmlrqitvndmpvgrsveevlrlleafqfvekhgevcpanwkkgdp
gmkpepnasvegyfsk

Timeline for d4k1fd_:

• d4k1fd_ first appeared in SCOPe 2.04
  
• d4k1fd_ appears in SCOPe 2.05
  
• d4k1fd_ appears in SCOPe 2.07
  
• d4k1fd_ appears in the current release, SCOPe 2.08