Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (19 species) not a true protein |
Species Leishmania major [TaxId:5664] [226407] (3 PDB entries) |
Domain d4k1fd_: 4k1f D: [240370] automated match to d4k1fa_ complexed with cl, pe8, peg, pge |
PDB Entry: 4k1f (more details), 2.34 Å
SCOPe Domain Sequences for d4k1fd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k1fd_ c.47.1.10 (D:) automated matches {Leishmania major [TaxId: 5664]} cgnakinspapsfeevalmpngsfkkislssykgkwvvlffypldftfvcpteviafsds vsrfnelncevlacsidseyahlqwtlqdrkkgglgtmaipiladktkniarsygvlees qgvayrglfiidphgmlrqitvndmpvgrsveevlrlleafqfvekhgevcpanwkkgdp gmkpepnasvegyfsk
Timeline for d4k1fd_:
View in 3D Domains from other chains: (mouse over for more information) d4k1fa_, d4k1fb_, d4k1fc_, d4k1fe_ |