SCOPe 2.07: Domain d2lal.2: 2lal C:,D:

Lineage for d2lal.2 (2lal C:,D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
   two-chain protein resulted from a single-chain precursor

8. Domain d2lal.2: 2lal C:,D: [24037]
   complexed with ca, mn, po4

Details for d2lal.2

PDB Entry: 2lal, 1.8 Å

PDB Description: crystal structure determination and refinement at 2.3 angstroms resolution of the lentil lectin

PDB Compounds: (C:) lentil lectin (alpha chain), (D:) lentil lectin (beta chain)

SCOPe Domain Sequences for d2lal.2:

Sequence; same for both SEQRES and ATOM records:

>g2lal.2 b.29.1.1 (C:,D:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg

Timeline for d2lal.2:

• d2lal.2 first appeared (with stable ids) in SCOP 1.55
  
• d2lal.2 appears in SCOPe 2.06
  
• d2lal.2 appears in the current release, SCOPe 2.08