Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries) two-chain protein resulted from a single-chain precursor |
Domain d2lal.2: 2lal C:,D: [24037] complexed with ca, mn, po4 |
PDB Entry: 2lal (more details), 1.8 Å
SCOPe Domain Sequences for d2lal.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g2lal.2 b.29.1.1 (C:,D:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]} tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg
Timeline for d2lal.2:
View in 3D Domains from other chains: (mouse over for more information) d2lal.1, d2lal.1, d2lal.1, d2lal.1 |